| Name | FNDC3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1835 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FNDC3B antibody was raised using the N terminal of FNDC3B corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FNDC3B Blocking Peptide |
| Description | Rabbit polyclonal FNDC3B antibody raised against the N terminal of FNDC3B |
| Gene | FNDC3B |
| Supplier Page | Shop |