| Name | UGT8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7132 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UGT8 antibody was raised using the middle region of UGT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI |
| Purity/Format | Affinity purified |
| Blocking Peptide | UGT8 Blocking Peptide |
| Description | Rabbit polyclonal UGT8 antibody raised against the middle region of UGT8 |
| Gene | UGT8 |
| Supplier Page | Shop |