| Name | AURKC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2679 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | AURKC Blocking Peptide |
| Description | Rabbit polyclonal AURKC antibody raised against the middle region of AURKC |
| Gene | AURKC |
| Supplier Page | Shop |