| Name | Septin 11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5568 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET |
| Purity/Format | Affinity purified |
| Blocking Peptide | Septin 11 Blocking Peptide |
| Description | Rabbit polyclonal Septin 11 antibody raised against the N terminal of 40432 |
| Gene | SEPT11 |
| Supplier Page | Shop |