Name | Septin 11 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5568 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET |
Purity/Format | Affinity purified |
Blocking Peptide | Septin 11 Blocking Peptide |
Description | Rabbit polyclonal Septin 11 antibody raised against the N terminal of 40432 |
Gene | SEPT11 |
Supplier Page | Shop |