AKR1C2 antibody

Name AKR1C2 antibody
Supplier Fitzgerald
Catalog 70R-4045
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
Purity/Format Affinity purified
Blocking Peptide AKR1C2 Blocking Peptide
Description Rabbit polyclonal AKR1C2 antibody
Gene AKR1C2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.