| Name | Synaptojanin 2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4941 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Synaptojanin 2 Blocking Peptide |
| Description | Rabbit polyclonal Synaptojanin 2 antibody raised against the N terminal of SYNJ2 |
| Gene | SYNJ2 |
| Supplier Page | Shop |