Name | GPR27 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7335 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV |
Purity/Format | Affinity purified |
Blocking Peptide | GPR27 Blocking Peptide |
Description | Rabbit polyclonal GPR27 antibody raised against the middle region of GPR27 |
Gene | GPR27 |
Supplier Page | Shop |