GPR27 antibody

Name GPR27 antibody
Supplier Fitzgerald
Catalog 70R-7335
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV
Purity/Format Affinity purified
Blocking Peptide GPR27 Blocking Peptide
Description Rabbit polyclonal GPR27 antibody raised against the middle region of GPR27
Gene GPR27
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.