Name | CHRNA5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1529 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CHRNA5 Blocking Peptide |
Description | Rabbit polyclonal CHRNA5 antibody raised against the middle region of CHRNA5 |
Gene | CHRNA5 |
Supplier Page | Shop |