| Name | CHRNA5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1529 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CHRNA5 Blocking Peptide |
| Description | Rabbit polyclonal CHRNA5 antibody raised against the middle region of CHRNA5 |
| Gene | CHRNA5 |
| Supplier Page | Shop |