| Name | ALLC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3698 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALLC Blocking Peptide |
| Description | Rabbit polyclonal ALLC antibody raised against the N terminal of ALLC |
| Gene | ALLC |
| Supplier Page | Shop |