| Name | Anti-HSFY2 (aa 51-100) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPABH-13032 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide within Human HSFY2 aa 51-100 (internal sequence). The exact sequence is proprietary.Sequence: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE Database link: Q96LI6-3 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | HSFY2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |