Name | Anti-HSFY2 (aa 51-100) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-13032 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide within Human HSFY2 aa 51-100 (internal sequence). The exact sequence is proprietary.Sequence: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE Database link: Q96LI6-3 Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | HSFY2 |
Conjugate | Unconjugated |
Supplier Page | Shop |