ADE2 Antibody
| Name | ADE2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90235 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ADE2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PAICS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ADE2 Antibody [NBP1-90235] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5691_ADE2-Antibody-Western-Blot-NBP1-90235-img0007.jpg)
Western Blot: ADE2 Antibody [NBP1-90235] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5692_ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0002.jpg)
Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Western Blot: ADE2 Antibody [NBP1-90235] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5693_ADE2-Antibody-Western-Blot-NBP1-90235-img0004.jpg)
Western Blot: ADE2 Antibody [NBP1-90235] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Simple Western: ADE2 Antibody [NBP1-90235] - Simple Western lane view shows a specific band for ADE2 in 0.2 mg/ml of RT-4 and U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5694_ADE2-Antibody-Simple-Western-NBP1-90235-img0005.jpg)
Simple Western: ADE2 Antibody [NBP1-90235] - Simple Western lane view shows a specific band for ADE2 in 0.2 mg/ml of RT-4 and U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5695_ADE2-Antibody-Simple-Western-NBP1-90235-img0006.jpg)
Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).