| Name | C15ORF24, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301660 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C15ORF24 antibody was raised using the middle region of C15Orf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD |
| Purity/Format | Affinity purified |
| Description | C15ORF24 antibody |
| Gene | EMC7 |
| Supplier Page | Shop |