TRNT1, Polyclonal Antibody

Name TRNT1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300157
Prices $370.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Purity/Format Total IgG Protein A purified
Description TRNT1 antibody
Gene TRNT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.