TRNT1 antibody
| Name | TRNT1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343834 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TRNT1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TRNT1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain