KIAA1430 Antibody

Name KIAA1430 Antibody
Supplier Novus Biologicals
Catalog NBP2-47408
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: EGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLP
Purity/Format Immunogen affinity purified
Blocking Peptide KIAA1430 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CFAP97
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.