p53 AIP1 Antibody
| Name | p53 AIP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13465 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSD PLVLGAQVHGGC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | p53 AIP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TP53AIP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: p53 AIP1 Antibody [NBP2-13465] Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3162_p53%2520AIP1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13465-img0001.jpg)
Immunohistochemistry-Paraffin: p53 AIP1 Antibody [NBP2-13465] Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.