RAB3IL1 Antibody
| Name | RAB3IL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86245 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAB3IL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RAB3IL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RAB3IL1 Antibody [NBP1-86245] - Staining of human cerebellum shows strong cytoplasmic staining in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4178_RAB3IL1-Antibody-Immunohistochemistry-NBP1-86245-img0003.jpg)
Immunohistochemistry: RAB3IL1 Antibody [NBP1-86245] - Staining of human cerebellum shows strong cytoplasmic staining in Purkinje cells.