CRY1 Antibody
| Name | CRY1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69080 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CRY1 (cryptochrome 1 (photolyase-like)) The peptide sequence was selected from the N terminal of CRY1 (NP_004066) Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CRY1 Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | CRY1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1892_CRY1-Antibody-Western-Blot-NBP1-69080-img0007.jpg)
Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%
![Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1893_CRY1-Antibody-Immunohistochemistry-Paraffin-NBP1-69080-img0003.jpg)
Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.
![Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1894_CRY1-Antibody-Western-Blot-NBP1-69080-img0004.jpg)
Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.
![Simple Western: CRY1 Antibody [NBP1-69080] - Simple Western lane view shows a specific band for CRY1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1895_CRY1-Antibody-Simple-Western-NBP1-69080-img0006.jpg)
Simple Western: CRY1 Antibody [NBP1-69080] - Simple Western lane view shows a specific band for CRY1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.