LIV-1/Zip6 Antibody

Name	LIV-1/Zip6 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-59357
Prices	$299.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to SLC39A6(solute carrier family 39 (zinc transporter), member 6) The peptide sequence was selected from the middle region of SLC39A6. Peptide sequence RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN.
Purity/Format	Protein A purified
Description	Rabbit Polyclonal
Gene	SLC39A6
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP1-59357] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: MCF7.

Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 721_B.

Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 293T.

Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: Human Fetal Brain.