Pannexin-1 Antibody
| Name | Pannexin-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59672 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PANX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Pannexin-1 Antibody [NBP1-59672] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16697_Pannexin-1-Antibody-Western-Blot-NBP1-59672-img0009.jpg)
Western Blot: Pannexin-1 Antibody [NBP1-59672] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Paraffin Embedded Tissue: Human neural cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16698_Pannexin-1-Antibody-Immunohistochemistry-NBP1-59672-img0008.jpg)
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Paraffin Embedded Tissue: Human neural cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Western Blot: Pannexin-1 Antibody [NBP1-59672] - Tissue: Hela whole cell lysates](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16699_Pannexin-1-Antibody-Western-Blot-NBP1-59672-img0004.jpg)
Western Blot: Pannexin-1 Antibody [NBP1-59672] - Tissue: Hela whole cell lysates
![Western Blot: Pannexin-1 Antibody [NBP1-59672] - PANX1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16700_Pannexin-1-Antibody-Western-Blot-NBP1-59672-img0001.jpg)
Western Blot: Pannexin-1 Antibody [NBP1-59672] - PANX1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate
![Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672] - Mouse Retina and Knockout PANX-1 Mouse Tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16701_Pannexin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-59672-img0003.jpg)
Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-59672] - Mouse Retina and Knockout PANX-1 Mouse Tissue.
![Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Jurkat cell lysate Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16702_Pannexin-1-Antibody-Immunohistochemistry-NBP1-59672-img0006.jpg)
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Jurkat cell lysate Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Intestine](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16703_Pannexin-1-Antibody-Immunohistochemistry-NBP1-59672-img0007.jpg)
Immunohistochemistry: Pannexin-1 Antibody [NBP1-59672] - Human Intestine