NHE3/SLC9A3 Antibody
| Name | NHE3/SLC9A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82574 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NHE3/SLC9A3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC9A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in control (vector only transfected HEK293T lysate) and sLC9A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22027_NHE3-SLC9A3%2520Antibody-Western%2520Blot-NBP1-82574-img0008.jpg)
Western Blot: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in control (vector only transfected HEK293T lysate) and sLC9A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human small intestine shows strong apical membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22028_NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0007.jpg)
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human small intestine shows strong apical membrane positivity in glandular cells.
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human kidney shows strong apical membrane positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22029_NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0004.jpg)
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human kidney shows strong apical membrane positivity in cells in tubules.
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human colon shows strong apical membrane positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22030_NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0005.jpg)
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human colon shows strong apical membrane positivity in glandular cells.
![Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human liver shows no positivity as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22031_NHE3-SLC9A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82574-img0006.jpg)
Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human liver shows no positivity as expected.