HSD17B6 Antibody
| Name | HSD17B6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56686 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HSD17B6(hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)) The peptide sequence was selected from the N terminal of HSD17B6 (NP_003716). Peptide sequence MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | HSD17B6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HSD17B6 Antibody [NBP1-56686] - A172 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14517_HSD17B6-Antibody-Western-Blot-NBP1-56686-img0002.jpg)
![Immunohistochemistry-Paraffin: HSD17B6 Antibody [NBP1-56686] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14518_HSD17B6-Antibody-Immunohistochemistry-Paraffin-NBP1-56686-img0004.jpg)