SLC38A3 Antibody

Name	SLC38A3 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-60103
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	SLC38A3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green DAPI: Blue Gene Name : SLC38A3 Submitted by : Anonymous

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. submitted by anonymous customer