Septin-11 Antibody
| Name | Septin-11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58144 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SEPT11(septin 11) The peptide sequence was selected from the N terminal of 40432. Peptide sequence MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SEPT11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Septin-11 Antibody [NBP1-58144] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12612_Septin-11-Antibody-Western-Blot-NBP1-58144-img0004.jpg)
Western Blot: Septin-11 Antibody [NBP1-58144] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry-Paraffin: Septin-11 Antibody [NBP1-58144] - Human Spleen Tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12613_Septin-11-Antibody-Immunohistochemistry-Paraffin-NBP1-58144-img0003.jpg)
Immunohistochemistry-Paraffin: Septin-11 Antibody [NBP1-58144] - Human Spleen Tissue, 5 ug/ml.
![Western Blot: Septin-11 Antibody [NBP1-58144] - 1. Human NT-2 cells (60ug) 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody : IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12614_Septin-11-Antibody-Western-Blot-NBP1-58144-img0001.jpg)
Western Blot: Septin-11 Antibody [NBP1-58144] - 1. Human NT-2 cells (60ug) 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody : IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000
![Western Blot: Septin-11 Antibody [NBP1-58144] - NT-2 cell line, mouse brain, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12615_Septin-11-Antibody-Western-Blot-NBP1-58144-img0002.jpg)
Western Blot: Septin-11 Antibody [NBP1-58144] - NT-2 cell line, mouse brain, Antibody Titration: 0.2-1 ug/ml
![Western Blot: Septin-11 Antibody [NBP1-58144] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12616_Septin-11%2520Antibody-Western%2520Blot-NBP1-58144-img0005.jpg)
Western Blot: Septin-11 Antibody [NBP1-58144] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.