PARP6 Antibody
| Name | PARP6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53045 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to PARP6(poly (ADP-ribose) polymerase family, member 6) The peptide sequence was selected from the C terminal of PARP6. Peptide sequence KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PARP6 |
| Supplier Page | Shop |
Product images
![Western Blot: PARP6 Antibody [NBP1-53045] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9859_PARP6%2520Antibody-Western%2520Blot-NBP1-53045-img0001.jpg)
Western Blot: PARP6 Antibody [NBP1-53045] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: PARP6 Antibody [NBP1-53045] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9860_PARP6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-53045-img0002.jpg)
Immunohistochemistry-Paraffin: PARP6 Antibody [NBP1-53045] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.