NTN4 Antibody
| Name | NTN4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91343 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide directed towards the N terminal of human NTN4. Peptide sequence EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NTN4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NTN4 Antibody [NBP1-91343] - Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: MCF7 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29757_NTN4%2520Antibody-Western%2520Blot-NBP1-91343-img0001.jpg)
![Immunohistochemistry-Paraffin: NTN4 Antibody [NBP1-91343] - rat and mouse brain, 10 ug/ml. Observed staining in cytoplasmin neurons](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29758_NTN4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91343-img0002.jpg)