HIC1 Antibody (4E11.)

Name	HIC1 Antibody (4E11.)
Supplier	Novus Biologicals
Catalog	H00003090-M01
Prices	$359.00
Sizes	100 µg
Host	Mouse
Clonality	Monoclonal
Isotype	IgG2b Kappa
Clone	4E11.
Applications	WB ELISA ICC/IF
Species Reactivities	Human, Rat
Antigen	HIC1 (NP_006488 396 a.a. - 453 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
Purity/Format	IgG purified
Description	Mouse Monoclonal
Gene	HIC1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11. Analysis of HIC1 expression in PC-12.

Immunocytochemistry/Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.

Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.