SYNPO2L Antibody

Name SYNPO2L Antibody
Supplier Novus Biologicals
Catalog NBP2-34156
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: PVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGPGLGPR
Purity/Format Immunogen affinity purified
Blocking Peptide SYNPO2L Protein
Description Rabbit Polyclonal
Gene SYNPO2L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.