GPBP Antibody

Name GPBP Antibody
Supplier Novus Biologicals
Catalog NBP1-80012
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human DKFZP761C169. Peptide sequence RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GPBP1
Conjugate Unconjugated
Supplier Page Shop

Product images