SYNPO2L Antibody
| Name | SYNPO2L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33741 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYNPO2L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYNPO2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SYNPO2L Antibody [NBP2-33741] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25319_SYNPO2L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33741-img0006.jpg)
Immunocytochemistry/Immunofluorescence: SYNPO2L Antibody [NBP2-33741] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cell junctions.
![Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-33741] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25320_SYNPO2L-Antibody-Immunohistochemistry-Paraffin-NBP2-33741-img0005.jpg)
Immunohistochemistry-Paraffin: SYNPO2L Antibody [NBP2-33741] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.