RAPGEF3 Antibody

Name RAPGEF3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57044
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3) The peptide sequence was selected from the N terminal of RAPGEF3. Peptide sequence RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAPGEF3
Conjugate Unconjugated
Supplier Page Shop

Product images