PARP6 Antibody

Name PARP6 Antibody
Supplier Novus Biologicals
Catalog NBP1-52950
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PARP6 (poly (ADP-ribose) polymerase family, member 6) The peptide sequence was selected from the N terminal of PARP6. Peptide sequence HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PARP6
Conjugate Unconjugated
Supplier Page Shop

Product images