BNC2 Antibody

Name BNC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-69078
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Bnc2 (basonuclin 2) The peptide sequence was selected from the C terminal of Bnc2. Peptide sequence GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BNC2
Conjugate Unconjugated
Supplier Page Shop

Product images