IFT88 Antibody
| Name | IFT88 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14117 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: YKEALRNDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLY QIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYD |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFT88 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: IFT88 Antibody [NBP2-14117] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23716_IFT88%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14117-img0002.jpg)
![Immunohistochemistry-Paraffin: IFT88 Antibody [NBP2-14117] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23717_IFT88%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14117-img0001.jpg)