Nicotinic Acetylcholine Receptor epsilon Antibody

Name Nicotinic Acetylcholine Receptor epsilon Antibody
Supplier Novus Biologicals
Catalog NBP1-79951
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human CHRNE. Peptide sequence GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene CHRNE
Conjugate Unconjugated
Supplier Page Shop

Product images