LURAP1 Antibody

Name LURAP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56823
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NF-kappaB activator C1orf190 The peptide sequence was selected from the middle region of NF-kappaB activator C1orf190. Peptide sequence SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LURAP1
Conjugate Unconjugated
Supplier Page Shop

Product images