ALLC Antibody

Name ALLC Antibody
Supplier Novus Biologicals
Catalog NBP1-55395
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ALLC(allantoicase) The peptide sequence was selected from the N terminal of ALLC. Peptide sequence VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ALLC
Conjugate Unconjugated
Supplier Page Shop

Product images