EMC7 Antibody

Name EMC7 Antibody
Supplier Novus Biologicals
Catalog NBP1-62595
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C15ORF24 The peptide sequence was selected from the middle region of C15ORF24. Peptide sequence VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EMC7
Conjugate Unconjugated
Supplier Page Shop

Product images