SLC22A6 Antibody

Name SLC22A6 Antibody
Supplier Novus Biologicals
Catalog NBP1-69694
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A6(solute carrier family 22 (organic anion transporter), member 6) The peptide sequence was selected from the N terminal of SLC22A6. Peptide sequence AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHC
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC22A6
Conjugate Unconjugated
Supplier Page Shop

Product images