INPP5F Antibody
| Name | INPP5F Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81693 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IGIRSQNQGSLAQGKNFLMSKFSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVMDKVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | INPP5F Protein |
| Description | Rabbit Polyclonal |
| Gene | OCRL |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: INPP5F Antibody [NBP1-81693] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23922_INPP5F-Antibody-Immunohistochemistry-NBP1-81693-img0002.jpg)
Immunohistochemistry: INPP5F Antibody [NBP1-81693] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.