LHX6 Antibody
| Name | LHX6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14192 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVH LKADMDGPLSNRGEKVIL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LHX6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LHX6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: LHX6 Antibody [NBP2-14192] Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/583_LHX6%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14192-img0001.jpg)
Immunohistochemistry-Paraffin: LHX6 Antibody [NBP2-14192] Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.