Netrin-4 Antibody
| Name | Netrin-4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70757 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to Netrin-4 The peptide sequence was selected from the C terminal of Netrin-4. Peptide sequence FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NTN4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Netrin-4 Antibody [NBP1-70757] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15802_Netrin-4%2520Antibody-Western%2520Blot-NBP1-70757-img0002.jpg)
Western Blot: Netrin-4 Antibody [NBP1-70757] - HepG2 cell lysate, concentration 2.5 ug/ml.