IGFLR1/TMEM149 Antibody
| Name | IGFLR1/TMEM149 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69417 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM149(transmembrane protein 149) The peptide sequence was selected from the N terminal of TMEM149. Peptide sequence WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IGFLR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: U2AF1L4 Antibody [NBP1-69417] - This Anti-TMEM149 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15283_U2AF1L4%2520Antibody-Western%2520Blot-NBP1-69417-img0001.jpg)
Western Blot: U2AF1L4 Antibody [NBP1-69417] - This Anti-TMEM149 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.