PARP3 antibody

Name PARP3 antibody
Supplier Fitzgerald
Catalog 70R-2120
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
Purity/Format Affinity purified
Blocking Peptide PARP3 Blocking Peptide
Description Rabbit polyclonal PARP3 antibody
Gene PARP3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.