| Name | RALY antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2071 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RALY Blocking Peptide |
| Description | Rabbit polyclonal RALY antibody raised against the N terminal of RALY |
| Gene | RALY |
| Supplier Page | Shop |