CNP antibody

Name CNP antibody
Supplier Fitzgerald
Catalog 70R-2044
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
Purity/Format Affinity purified
Blocking Peptide CNP Blocking Peptide
Description Rabbit polyclonal CNP antibody raised against the middle region of CNP
Gene CNP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.