EME1 antibody

Name EME1 antibody
Supplier Fitzgerald
Catalog 70R-3166
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR
Purity/Format Affinity purified
Blocking Peptide EME1 Blocking Peptide
Description Rabbit polyclonal EME1 antibody
Gene EME1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.