| Name | C1ORF190 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4302 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C1ORF190 antibody was raised using the middle region of C1Orf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1ORF190 Blocking Peptide |
| Description | Rabbit polyclonal C1ORF190 antibody raised against the middle region of C1Orf190 |
| Gene | LURAP1 |
| Supplier Page | Shop |