| Name | AHSG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5916 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL |
| Purity/Format | Affinity purified |
| Blocking Peptide | AHSG Blocking Peptide |
| Description | Rabbit polyclonal AHSG antibody raised against the N terminal of AHSG |
| Gene | AHSG |
| Supplier Page | Shop |