Destrin antibody

Name Destrin antibody
Supplier Fitzgerald
Catalog 70R-3884
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE
Purity/Format Affinity purified
Blocking Peptide Destrin Blocking Peptide
Description Rabbit polyclonal Destrin antibody
Gene DSTN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.